(data stored in ACNUC7421 zone)

EMBL: CP000675.PE211

CP000675.PE211       Location/Qualifiers
FT   CDS             complement(226092..226850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54211"
FT                   /protein_id="ABQ54211.1"
FT                   /translation="MNTFKEIAYQILLEAGKPLHSKEITALALKLGRLNSAGKTPDLTM
FT                   NAELNVDINTKKAASCFIKVAPSVFAINNDKYLSSDLKLMADKEYKISPNISTQQKGHI
FT                   AEARIAELITLYGDTTLSCYRPVSDDEGIDLIVKEKGSLKTIYLQIKSRFESNPSRSFT
FT                   STIRSCNLHDHHAMAVIFCLFDTDAGDLCNQLWFVPACSLIKNAHKLQNGDFFGFVAGK
FT                   RKKESNKWDEFLIDKRDLANQIIASIKRIS"
     MNTFKEIAYQ ILLEAGKPLH SKEITALALK LGRLNSAGKT PDLTMNAELN VDINTKKAAS        60
     CFIKVAPSVF AINNDKYLSS DLKLMADKEY KISPNISTQQ KGHIAEARIA ELITLYGDTT       120
     LSCYRPVSDD EGIDLIVKEK GSLKTIYLQI KSRFESNPSR SFTSTIRSCN LHDHHAMAVI       180
     FCLFDTDAGD LCNQLWFVPA CSLIKNAHKL QNGDFFGFVA GKRKKESNKW DEFLIDKRDL       240
     ANQIIASIKR IS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page