(data stored in ACNUC7421 zone)

EMBL: CP000675.PE215

CP000675.PE215       Location/Qualifiers
FT   CDS             complement(232516..233283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54215"
FT                   /protein_id="ABQ54215.1"
FT                   /translation="MRIKRKIIRHGFFWLPNSKKEVKGTLIILDGGKISLRLENLLHPQ
FT                   NELIKIIHGRIGETAITLVDSYCKVYNDLISMISGGYGFEMHVHEAIFGQFFPSEEITT
FT                   VEVYFWLEGIDNWINEINHLDVSNKLNISKDYNFILQKHAGGIKFKLSSHNPQLLSEYR
FT                   KIIQKIILFFYFILNKPTNLQKIIIKSAGNKKLPIYYQSIPFNHKKYPSKSGFIQPGDI
FT                   DNLPRIIENWFNFYDSYSPCVFRSEMITDSGHT"
     MRIKRKIIRH GFFWLPNSKK EVKGTLIILD GGKISLRLEN LLHPQNELIK IIHGRIGETA        60
     ITLVDSYCKV YNDLISMISG GYGFEMHVHE AIFGQFFPSE EITTVEVYFW LEGIDNWINE       120
     INHLDVSNKL NISKDYNFIL QKHAGGIKFK LSSHNPQLLS EYRKIIQKII LFFYFILNKP       180
     TNLQKIIIKS AGNKKLPIYY QSIPFNHKKY PSKSGFIQPG DIDNLPRIIE NWFNFYDSYS       240
     PCVFRSEMIT DSGHT                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page