(data stored in ACNUC7421 zone)

EMBL: CP000675.PE217

CP000675.PE217       Location/Qualifiers
FT   CDS             235158..235505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54217"
FT                   /protein_id="ABQ54217.1"
FT                   /translation="MVRLLRIEFSGGLYHINSRGNRKEAIYLSDADRENFLSVLGDVCL
FT                   KYQWLCHSYCLMTNHYHLLIETPLGNLSKGMRYLNGVYTQKFNKSHKRIGHVLQGCYKS
FT                   ILVTTQEFAEL"
     MVRLLRIEFS GGLYHINSRG NRKEAIYLSD ADRENFLSVL GDVCLKYQWL CHSYCLMTNH        60
     YHLLIETPLG NLSKGMRYLN GVYTQKFNKS HKRIGHVLQG CYKSILVTTQ EFAEL            115
//

If you have problems or comments...

PBIL Back to PBIL home page