(data stored in ACNUC7421 zone)

EMBL: CP000675.PE22

CP000675.PE22        Location/Qualifiers
FT   CDS             27124..27603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0022"
FT                   /product="conserved hypothetical protein; DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54022"
FT                   /protein_id="ABQ54022.1"
FT                   /translation="MDEQISKSQKKRDAHYLQDIGIKFIDLSASKLDSLPLPDNLRQAI
FT                   IDARSIKSHGAKRRQAQLIGKLMRAADFEAILAAYEKILEEESSITASFHEIELWRDRL
FT                   LQDGKDALTEFIDAYQPEDVQQLRQLIKKALDDQMKEKNTGAAKALFRYLRSLIK"
     MDEQISKSQK KRDAHYLQDI GIKFIDLSAS KLDSLPLPDN LRQAIIDARS IKSHGAKRRQ        60
     AQLIGKLMRA ADFEAILAAY EKILEEESSI TASFHEIELW RDRLLQDGKD ALTEFIDAYQ       120
     PEDVQQLRQL IKKALDDQMK EKNTGAAKAL FRYLRSLIK                              159
//

If you have problems or comments...

PBIL Back to PBIL home page