(data stored in ACNUC7421 zone)

EMBL: CP000675.PE220

CP000675.PE220       Location/Qualifiers
FT   CDS             236835..237590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54220"
FT                   /protein_id="ABQ54220.1"
FT                   /translation="MAITTTHIEPREKAQIAKLVVTYAGFSEIPVYAGIGTTRNDPREL
FT                   FLQQNPLWPPFFGYPDSLPEESPWFPQQAVPYRQMNHSIFDEMNIEEESAPEYLARIAK
FT                   NYSPQHKLVIVSLGPLHNISAALKINPSISSNLKIYSMGGIYPKGYNWLVSPEVTAPVL
FT                   GSTEVISIVSQFVDAHDFYITPEEFLEIEKSAQSEFGLAVIQDWKNWYNIDKRNLNKTH
FT                   LSDPVTLYLALHPEEITHMSSKLLTFPCH"
     MAITTTHIEP REKAQIAKLV VTYAGFSEIP VYAGIGTTRN DPRELFLQQN PLWPPFFGYP        60
     DSLPEESPWF PQQAVPYRQM NHSIFDEMNI EEESAPEYLA RIAKNYSPQH KLVIVSLGPL       120
     HNISAALKIN PSISSNLKIY SMGGIYPKGY NWLVSPEVTA PVLGSTEVIS IVSQFVDAHD       180
     FYITPEEFLE IEKSAQSEFG LAVIQDWKNW YNIDKRNLNK THLSDPVTLY LALHPEEITH       240
     MSSKLLTFPC H                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page