(data stored in ACNUC7421 zone)

EMBL: CP000675.PE222

CP000675.PE222       Location/Qualifiers
FT   CDS             238077..240572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54222"
FT                   /protein_id="ABQ54222.1"
FT                   /translation="MKLPFKEPVAPRYIYINPQTNVVHLLMPVMSGTEIGLDNTCKSVY
FT                   SLLEFFCLLGANQQSAASMILKNYQEGLAFDIKYHPNSEQKALKEQRLVQINMYLRLLQ
FT                   QVQQEEQITNPLKLIFPTYPAALESLMQASEANLHSVILRPEEQDVQLRTTAISPVFSA
FT                   HHDTMVNGQRIEKKSSLYEILSNSYEGLVFIPKSKEQLIERVLSKCADSPVDFEHIRAM
FT                   LTQETKAYLGIEESFNQTQGNRYAPSAPVNQAYIDGELMISAEYPATPQDYLNALLEYC
FT                   TPNLFDNIEESPFYTINNKERLSILTQFFLAELNIICREEGIAETNFGQILEANPELIN
FT                   NLAKCVKQALTGYQSVEDALINYVNQHRDDFQFTSPIPQYSFPKLKERFNSHYKQIKDS
FT                   PHFDEFMLLSTKKGLFFAHQGCIATHFAHFMNALFFNDILDENTKTFLQSVQQDFETID
FT                   KFENTIPHQNTHINAGMKEAVLDLSSMDNEALQDLYEDINSYQDSNLKEALLAQLKQER
FT                   PDFKLQMNAKIFLQHVAYGEQDEAEELLNKDPELTQELLRANNIFFTDYSGRTFTCTAY
FT                   EYAYWAKDSHMQRMLEKYIRQDDETRQFMLERVKAIEELVNPPEAERFFAHPKPRGLHY
FT                   TTQNKEGKTIDHWEAHVDLTPLKKALQHFLDEFKKLYNNPKPNNYREVLNNIWVKEVGM
FT                   AQRCVPAHIAQEYCRVGWDLFLGLKDNKALFDASNPNNLKRQLKIFDWNTYTYDLWFTP
FT                   GSHAVDCGLGFSCALIRGGNNCPRPTNMYDRWTTPNEVVEQDLEMISIIDEVRTCDLKQ
FT                   SLENLSQPLIAQAAQYLSI"
     MKLPFKEPVA PRYIYINPQT NVVHLLMPVM SGTEIGLDNT CKSVYSLLEF FCLLGANQQS        60
     AASMILKNYQ EGLAFDIKYH PNSEQKALKE QRLVQINMYL RLLQQVQQEE QITNPLKLIF       120
     PTYPAALESL MQASEANLHS VILRPEEQDV QLRTTAISPV FSAHHDTMVN GQRIEKKSSL       180
     YEILSNSYEG LVFIPKSKEQ LIERVLSKCA DSPVDFEHIR AMLTQETKAY LGIEESFNQT       240
     QGNRYAPSAP VNQAYIDGEL MISAEYPATP QDYLNALLEY CTPNLFDNIE ESPFYTINNK       300
     ERLSILTQFF LAELNIICRE EGIAETNFGQ ILEANPELIN NLAKCVKQAL TGYQSVEDAL       360
     INYVNQHRDD FQFTSPIPQY SFPKLKERFN SHYKQIKDSP HFDEFMLLST KKGLFFAHQG       420
     CIATHFAHFM NALFFNDILD ENTKTFLQSV QQDFETIDKF ENTIPHQNTH INAGMKEAVL       480
     DLSSMDNEAL QDLYEDINSY QDSNLKEALL AQLKQERPDF KLQMNAKIFL QHVAYGEQDE       540
     AEELLNKDPE LTQELLRANN IFFTDYSGRT FTCTAYEYAY WAKDSHMQRM LEKYIRQDDE       600
     TRQFMLERVK AIEELVNPPE AERFFAHPKP RGLHYTTQNK EGKTIDHWEA HVDLTPLKKA       660
     LQHFLDEFKK LYNNPKPNNY REVLNNIWVK EVGMAQRCVP AHIAQEYCRV GWDLFLGLKD       720
     NKALFDASNP NNLKRQLKIF DWNTYTYDLW FTPGSHAVDC GLGFSCALIR GGNNCPRPTN       780
     MYDRWTTPNE VVEQDLEMIS IIDEVRTCDL KQSLENLSQP LIAQAAQYLS I                831
//

If you have problems or comments...

PBIL Back to PBIL home page