(data stored in ACNUC7421 zone)

EMBL: CP000675.PE225

CP000675.PE225       Location/Qualifiers
FT   CDS             241325..241840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54225"
FT                   /protein_id="ABQ54225.1"
FT                   /translation="MFNVSIRKATSLDAEAIASVHVHSWKKAYQQFIPEIVLNSLSIPE
FT                   RTQLWNELLNNGVTVLVLEIDNQIIGFASICTFRDGIEDNSKGEISAIYIHPNFWHQGF
FT                   GKKLSLAALKTLKELGYTEALLWVLSDNHQARSFYEGMGFELNDKSKLAEFYDGGALLK
FT                   EVLYKKKL"
     MFNVSIRKAT SLDAEAIASV HVHSWKKAYQ QFIPEIVLNS LSIPERTQLW NELLNNGVTV        60
     LVLEIDNQII GFASICTFRD GIEDNSKGEI SAIYIHPNFW HQGFGKKLSL AALKTLKELG       120
     YTEALLWVLS DNHQARSFYE GMGFELNDKS KLAEFYDGGA LLKEVLYKKK L                171
//

If you have problems or comments...

PBIL Back to PBIL home page