(data stored in ACNUC7421 zone)

EMBL: CP000675.PE229

CP000675.PE229       Location/Qualifiers
FT   CDS             245146..245892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54229"
FT                   /protein_id="ABQ54229.1"
FT                   /translation="MKRYIWFHPSYVLESAEATLLGQQTNAKDHGYILLNDQELGQVTC
FT                   EDHLTIMGHSSLESTPSEDTGLYMQGDTADGLIRRLTANGLKEAPKILSLESCRAGISG
FT                   GLAQQLSCSLFFKYTLIEANLNSVGRKPMDTQWNFPTDSLGRAVLKLDNSPWMFYLGGF
FT                   LVGRLTHDTYTMENLFSLLSPPTFHKHFFANYQPGFFGGRSGRHCLFNKTTITLEKASN
FT                   FAHEDQDSASAKALEVVLKKLYSQPG"
     MKRYIWFHPS YVLESAEATL LGQQTNAKDH GYILLNDQEL GQVTCEDHLT IMGHSSLEST        60
     PSEDTGLYMQ GDTADGLIRR LTANGLKEAP KILSLESCRA GISGGLAQQL SCSLFFKYTL       120
     IEANLNSVGR KPMDTQWNFP TDSLGRAVLK LDNSPWMFYL GGFLVGRLTH DTYTMENLFS       180
     LLSPPTFHKH FFANYQPGFF GGRSGRHCLF NKTTITLEKA SNFAHEDQDS ASAKALEVVL       240
     KKLYSQPG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page