(data stored in ACNUC7421 zone)

EMBL: CP000675.PE232

CP000675.PE232       Location/Qualifiers
FT   CDS             249436..250635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54232"
FT                   /protein_id="ABQ54232.1"
FT                   /translation="MKIMNLNLKKLIGYFLAIVIFFSVVLWFLSHQGISVERAKVKYDH
FT                   FIQYIEDDAKTRAIKIYSIVSPVSGELLRINLTEGDKVKKDDVIATIKSKIPALLDIRA
FT                   KQELEHELGTAEALYEQAKAESIRAEAALETAQSDFKRKEPLAKKGFVSETELEHAQLE
FT                   YQLRQKEHNAALRKLHAAEHYILKVKASLSASEGSEASQQDKIEIRSPVTGSILRVIEK
FT                   SSTTVEPGTKIMDIADVVGLEVVADILSDDAAKIPPYARVIIKRWGGPYPLEGRVRIVE
FT                   PSGYTKISALGVEEQRVNVIIDITTPYELWKNLGDGYRVDVEIILFESNHALVVPMSAL
FT                   FRDGEDWAVFVVKGHRAYKKKLTIKYHNPDYAVIERGLELGDEVILYPSSLIHDGVLIK
FT                   "
     MKIMNLNLKK LIGYFLAIVI FFSVVLWFLS HQGISVERAK VKYDHFIQYI EDDAKTRAIK        60
     IYSIVSPVSG ELLRINLTEG DKVKKDDVIA TIKSKIPALL DIRAKQELEH ELGTAEALYE       120
     QAKAESIRAE AALETAQSDF KRKEPLAKKG FVSETELEHA QLEYQLRQKE HNAALRKLHA       180
     AEHYILKVKA SLSASEGSEA SQQDKIEIRS PVTGSILRVI EKSSTTVEPG TKIMDIADVV       240
     GLEVVADILS DDAAKIPPYA RVIIKRWGGP YPLEGRVRIV EPSGYTKISA LGVEEQRVNV       300
     IIDITTPYEL WKNLGDGYRV DVEIILFESN HALVVPMSAL FRDGEDWAVF VVKGHRAYKK       360
     KLTIKYHNPD YAVIERGLEL GDEVILYPSS LIHDGVLIK                              399
//

If you have problems or comments...

PBIL Back to PBIL home page