(data stored in ACNUC7421 zone)

EMBL: CP000675.PE237

CP000675.PE237       Location/Qualifiers
FT   CDS             complement(253256..253735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54237"
FT                   /protein_id="ABQ54237.1"
FT                   /translation="MKEKTAKQLKLFIIYLISYWLLSIISCLIAFGYDDSLRMLLASPK
FT                   SDLSGALLFFSSFIATALLFVFRYKTFSDKPYPYFIFGFYVGNVSLLMLFILDAFIREL
FT                   IVWKFPEFLLVFISPFVELVLSYLFFGFAFLAIIPAVTSAFILYGVQRKLLLPPI"
     MKEKTAKQLK LFIIYLISYW LLSIISCLIA FGYDDSLRML LASPKSDLSG ALLFFSSFIA        60
     TALLFVFRYK TFSDKPYPYF IFGFYVGNVS LLMLFILDAF IRELIVWKFP EFLLVFISPF       120
     VELVLSYLFF GFAFLAIIPA VTSAFILYGV QRKLLLPPI                              159
//

If you have problems or comments...

PBIL Back to PBIL home page