(data stored in ACNUC7421 zone)

EMBL: CP000675.PE238

CP000675.PE238       Location/Qualifiers
FT   CDS             complement(253748..253987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54238"
FT                   /protein_id="ABQ54238.1"
FT                   /translation="MIAWIIESSQYLSHLQDSRKEQSKEWEVLVLSSPVNAALCLIGKE
FT                   EKIDSVARSGSCPCINAPKSRVKIPKIEAPFKTA"
     MIAWIIESSQ YLSHLQDSRK EQSKEWEVLV LSSPVNAALC LIGKEEKIDS VARSGSCPCI        60
     NAPKSRVKIP KIEAPFKTA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page