(data stored in ACNUC7421 zone)

EMBL: CP000675.PE239

CP000675.PE239       Location/Qualifiers
FT   CDS             254047..255024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54239"
FT                   /protein_id="ABQ54239.1"
FT                   /translation="MNLKAEVFLNQNCAEMMIKKAAQLILGSDLDFEYTRGVQDIQVDL
FT                   GPAFMFSPDEEKTLWVSGKNQETLEKDLATLNKSSVYFFRTGTQGGAGHWQVLYYEAAK
FT                   SGWVSYSSQSNHFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAENIIHAA
FT                   NFVYILRTQNEVAAIEYCALNHEFHPEIKRTARAKAEPETRTKGEIHNHPKDLSCENLK
FT                   TIYSKHVALLHVINRLETGSKSYNPYWMGSQAKLNTILGALGACYQKGLDVESELSNSN
FT                   SELSKAINIRRLPSLFSFWGGKIESPVESRKIIDENRTYRRNNP"
     MNLKAEVFLN QNCAEMMIKK AAQLILGSDL DFEYTRGVQD IQVDLGPAFM FSPDEEKTLW        60
     VSGKNQETLE KDLATLNKSS VYFFRTGTQG GAGHWQVLYY EAAKSGWVSY SSQSNHFQVT       120
     DSNGKLTASG KGLLVPHANW GKENGNYAFL LVNASAENII HAANFVYILR TQNEVAAIEY       180
     CALNHEFHPE IKRTARAKAE PETRTKGEIH NHPKDLSCEN LKTIYSKHVA LLHVINRLET       240
     GSKSYNPYWM GSQAKLNTIL GALGACYQKG LDVESELSNS NSELSKAINI RRLPSLFSFW       300
     GGKIESPVES RKIIDENRTY RRNNP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page