(data stored in ACNUC7421 zone)

EMBL: CP000675.PE244

CP000675.PE244       Location/Qualifiers
FT   CDS             complement(258316..259200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54244"
FT                   /protein_id="ABQ54244.1"
FT                   /translation="MAGTSLLTLIDDIATALDDIAAMTKVATKKTAGVLGDDLALNAEQ
FT                   IIGIHANRELPVIGAVAKGSAVNKLILIPLAILINFFAPALVGILLILGGLYLCFEGFE
FT                   KIVEKIFHTKNEPAKKKIDIQTIDMRQFEKEKISGAVRTDFVLSAEIIVITLGTVAATS
FT                   LVNQIAVLTLISLIMTIGVYGLVACIVKLDDLGFILREKKHPLKQIGILLIGAAPILMK
FT                   ILSVAGTIAMFLVGGGIITHQITAIHHFTENLSAMMSIGIDFFIGIISGAITAALYFIF
FT                   KKMKSKFKLMNTK"
     MAGTSLLTLI DDIATALDDI AAMTKVATKK TAGVLGDDLA LNAEQIIGIH ANRELPVIGA        60
     VAKGSAVNKL ILIPLAILIN FFAPALVGIL LILGGLYLCF EGFEKIVEKI FHTKNEPAKK       120
     KIDIQTIDMR QFEKEKISGA VRTDFVLSAE IIVITLGTVA ATSLVNQIAV LTLISLIMTI       180
     GVYGLVACIV KLDDLGFILR EKKHPLKQIG ILLIGAAPIL MKILSVAGTI AMFLVGGGII       240
     THQITAIHHF TENLSAMMSI GIDFFIGIIS GAITAALYFI FKKMKSKFKL MNTK             294
//

If you have problems or comments...

PBIL Back to PBIL home page