(data stored in ACNUC7421 zone)

EMBL: CP000675.PE246

CP000675.PE246       Location/Qualifiers
FT   CDS             complement(259987..260697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0249"
FT                   /product="conserved hypothetical protein containing DUF330
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54246"
FT                   /protein_id="ABQ54246.1"
FT                   /translation="MKNQKHFLKFYCIRDRSWPASARASFEGIRFLSFSNYAEFRKKPV
FT                   KLLLLLLIVLTLCDCGRSKETQFYLLTPISPQKNSHNSYNHLQIGVDEVSIPDYMKKPQ
FT                   LMIHQTPHHLTLEEFNQWAGALDKNITLVLTTNLSTLMPGVVVQTSPWDNKFHPDYHLQ
FT                   VMISQFEIDIHGNSILRAEYLIYRKEELIYKGNAYYHIKVPLISIETLVQSMNTNLTHL
FT                   TEEIARFFIKNTTK"
     MKNQKHFLKF YCIRDRSWPA SARASFEGIR FLSFSNYAEF RKKPVKLLLL LLIVLTLCDC        60
     GRSKETQFYL LTPISPQKNS HNSYNHLQIG VDEVSIPDYM KKPQLMIHQT PHHLTLEEFN       120
     QWAGALDKNI TLVLTTNLST LMPGVVVQTS PWDNKFHPDY HLQVMISQFE IDIHGNSILR       180
     AEYLIYRKEE LIYKGNAYYH IKVPLISIET LVQSMNTNLT HLTEEIARFF IKNTTK           236
//

If you have problems or comments...

PBIL Back to PBIL home page