(data stored in ACNUC7421 zone)

EMBL: CP000675.PE248

CP000675.PE248       Location/Qualifiers
FT   CDS             complement(261448..262203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0251"
FT                   /product="probable ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54248"
FT                   /protein_id="ABQ54248.1"
FT                   /translation="MYVFRRFSKHIITFLHSLELAFRFLGHLVDSTIKVIFGKLSIVWP
FT                   NTLEMIYYSGARLVILLSFIGILLGATVSQTVYALLKPFQLHQRVLPIVQNILTHEILP
FT                   VLIGFILCIQAALHMVNTRLEHYQENPEAIILAQVLPIIVGMNIASLLLYVYLVSAIFF
FT                   SFYLTFHFMLGFTNNEFLSYVVSSTTLFDLIYSVVKTLILCIIVGLTSGYYYYEASIRH
FT                   IYLRKAVSRILTRGSFWLIIASMYITLTF"
     MYVFRRFSKH IITFLHSLEL AFRFLGHLVD STIKVIFGKL SIVWPNTLEM IYYSGARLVI        60
     LLSFIGILLG ATVSQTVYAL LKPFQLHQRV LPIVQNILTH EILPVLIGFI LCIQAALHMV       120
     NTRLEHYQEN PEAIILAQVL PIIVGMNIAS LLLYVYLVSA IFFSFYLTFH FMLGFTNNEF       180
     LSYVVSSTTL FDLIYSVVKT LILCIIVGLT SGYYYYEASI RHIYLRKAVS RILTRGSFWL       240
     IIASMYITLT F                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page