(data stored in ACNUC7421 zone)

EMBL: CP000675.PE25

CP000675.PE25        Location/Qualifiers
FT   CDS             complement(30482..30907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54025"
FT                   /protein_id="ABQ54025.1"
FT                   /translation="MMLKTQLTAFIGAVILAGSSLANPIKPEVCPSVPSIQSEGMSMSS
FT                   EILEGMYITYNLSHYNTSSSWVFIVGPIAAENDDMALAESNKLLSTMSGSPHPEDDGEG
FT                   NWICQYTTKSKDIIAFAIEADDMLSPLKMMRYLRTIR"
     MMLKTQLTAF IGAVILAGSS LANPIKPEVC PSVPSIQSEG MSMSSEILEG MYITYNLSHY        60
     NTSSSWVFIV GPIAAENDDM ALAESNKLLS TMSGSPHPED DGEGNWICQY TTKSKDIIAF       120
     AIEADDMLSP LKMMRYLRTI R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page