(data stored in ACNUC7421 zone)

EMBL: CP000675.PE250

CP000675.PE250       Location/Qualifiers
FT   CDS             262869..263567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54250"
FT                   /protein_id="ABQ54250.1"
FT                   /translation="MTTLYIKNLRYNEVAVCRALFEAAEKTEEGIKTKRYGMQLTADMP
FT                   GLWSPLSNYDIENDLRMARIHRNGRMREIGYLTVNLVFQFDSLDVTEYETKYGISAKDV
FT                   LEKAGFTCSQDAAGYSEPVSTSTRLLGQESKPEKPTQTSVVNTSFFSLKSVDTDKRFTK
FT                   STKPGILYEARSYGKIEDDTLKSYGFTDGQWERQKEGIENIVIIKKLTQSISPGPAVLD
FT                   EAVDNIPTLS"
     MTTLYIKNLR YNEVAVCRAL FEAAEKTEEG IKTKRYGMQL TADMPGLWSP LSNYDIENDL        60
     RMARIHRNGR MREIGYLTVN LVFQFDSLDV TEYETKYGIS AKDVLEKAGF TCSQDAAGYS       120
     EPVSTSTRLL GQESKPEKPT QTSVVNTSFF SLKSVDTDKR FTKSTKPGIL YEARSYGKIE       180
     DDTLKSYGFT DGQWERQKEG IENIVIIKKL TQSISPGPAV LDEAVDNIPT LS               232
//

If you have problems or comments...

PBIL Back to PBIL home page