(data stored in ACNUC7421 zone)

EMBL: CP000675.PE255

CP000675.PE255       Location/Qualifiers
FT   CDS             267974..269122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0259"
FT                   /product="chloramphenicol resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54255"
FT                   /protein_id="ABQ54255.1"
FT                   /translation="MKKSLIFLAIGMFTVGCNTFLIAGLLPQIGETLGQPVAVTGQGVS
FT                   LFSLTYLFSAPLFSLIFVNQPVKRMIQLAFTVFMLGNLITLLSENIMLFLIGRSLAGVG
FT                   SGIFTPLCISIAVHFASPSAKGRILSFIWSANSAGVVFGVPAGLYLSSSFHWQLSIASL
FT                   IILSLLALVGFSMQNIDIRLPKPSPFGGRLRLLVEPKTLSVIGITCFTALASLGLYSYV
FT                   TLIQSGSPNSLSMTLLSWGLGGFMGSSLIGVCIDRTGKPRVIMALILVGLMFALIAIPF
FT                   TRNLPYLGLIPFFMWGACGWAIVTPQQHILYELHENQGTILAAINSSALGLGAALGTLL
FT                   GGLLISSGFRGIYLPFSAATLLFFVLITQLIVINTSHKVNNT"
     MKKSLIFLAI GMFTVGCNTF LIAGLLPQIG ETLGQPVAVT GQGVSLFSLT YLFSAPLFSL        60
     IFVNQPVKRM IQLAFTVFML GNLITLLSEN IMLFLIGRSL AGVGSGIFTP LCISIAVHFA       120
     SPSAKGRILS FIWSANSAGV VFGVPAGLYL SSSFHWQLSI ASLIILSLLA LVGFSMQNID       180
     IRLPKPSPFG GRLRLLVEPK TLSVIGITCF TALASLGLYS YVTLIQSGSP NSLSMTLLSW       240
     GLGGFMGSSL IGVCIDRTGK PRVIMALILV GLMFALIAIP FTRNLPYLGL IPFFMWGACG       300
     WAIVTPQQHI LYELHENQGT ILAAINSSAL GLGAALGTLL GGLLISSGFR GIYLPFSAAT       360
     LLFFVLITQL IVINTSHKVN NT                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page