(data stored in ACNUC7421 zone)

EMBL: CP000675.PE257

CP000675.PE257       Location/Qualifiers
FT   CDS             complement(270519..271661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54257"
FT                   /protein_id="ABQ54257.1"
FT                   /translation="MLSKYDKLIYINLAQDQVTANIDTLIIHESPTILVKIPDGSDLKT
FT                   LVDPDFFPGPITNRTKIYFSAHGHEELDDMVLDRQKENPKIYKLDDVAAYFGKLLTNPD
FT                   FKNPDIKPRLTLVMSVCEGLGFAKNLQKKLFDDYGLLVDVIANKNVIHEQFVKPHHETT
FT                   AYLTHRETSIKGVGREHKRPHSKVLLTIDKEGTQQEIDAYELKWIEKVLNTIHQQVATF
FT                   GKWADFEKPENIKIQEGLNAFCHDVDALISLFINQDINLTANNLLALLLSCQKTTADPL
FT                   YKQAMNYEMFQIMTKNLINEGLRYINPKIEMQEYSHALEELQSQKDKMIRDEVAPNIFR
FT                   AKKAIFSALLAEASEYGIDSVLEQLEKAKQELSQGKMNPS"
     MLSKYDKLIY INLAQDQVTA NIDTLIIHES PTILVKIPDG SDLKTLVDPD FFPGPITNRT        60
     KIYFSAHGHE ELDDMVLDRQ KENPKIYKLD DVAAYFGKLL TNPDFKNPDI KPRLTLVMSV       120
     CEGLGFAKNL QKKLFDDYGL LVDVIANKNV IHEQFVKPHH ETTAYLTHRE TSIKGVGREH       180
     KRPHSKVLLT IDKEGTQQEI DAYELKWIEK VLNTIHQQVA TFGKWADFEK PENIKIQEGL       240
     NAFCHDVDAL ISLFINQDIN LTANNLLALL LSCQKTTADP LYKQAMNYEM FQIMTKNLIN       300
     EGLRYINPKI EMQEYSHALE ELQSQKDKMI RDEVAPNIFR AKKAIFSALL AEASEYGIDS       360
     VLEQLEKAKQ ELSQGKMNPS                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page