(data stored in ACNUC7421 zone)

EMBL: CP000675.PE268

CP000675.PE268       Location/Qualifiers
FT   CDS             complement(284799..285791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54268"
FT                   /protein_id="ABQ54268.1"
FT                   /translation="MPKTKYALPPVVLYESHADRATSDFLIKQLPDLKKAGYTTICVDG
FT                   MEPGASLEENISMMKILIKMQIKKLSELPLEHPEYEQGIAKLRSVVAKLDLFEAMKEQG
FT                   FKLGGIDLPVSEQLKEKSLNSIRREQTLTDNTLRHVKENDGGVVVVLGFGHCIFQQMIK
FT                   EQDENADQYLWYHVHNPDNETQAYKELVESYTKKGLSTYFPLGVNIFKSSDKKLDTDFW
FT                   NKVSANCYNYDPKALETSTASILKSLLGPEVTAHLRTDGQHHVDALISLETVQKKHQVK
FT                   SSDFLRSLSKTLGDIHFEVAKIKTKDQVIIRGINEPEVAEQISKLSKKM"
     MPKTKYALPP VVLYESHADR ATSDFLIKQL PDLKKAGYTT ICVDGMEPGA SLEENISMMK        60
     ILIKMQIKKL SELPLEHPEY EQGIAKLRSV VAKLDLFEAM KEQGFKLGGI DLPVSEQLKE       120
     KSLNSIRREQ TLTDNTLRHV KENDGGVVVV LGFGHCIFQQ MIKEQDENAD QYLWYHVHNP       180
     DNETQAYKEL VESYTKKGLS TYFPLGVNIF KSSDKKLDTD FWNKVSANCY NYDPKALETS       240
     TASILKSLLG PEVTAHLRTD GQHHVDALIS LETVQKKHQV KSSDFLRSLS KTLGDIHFEV       300
     AKIKTKDQVI IRGINEPEVA EQISKLSKKM                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page