(data stored in ACNUC7421 zone)

EMBL: CP000675.PE269

CP000675.PE269       Location/Qualifiers
FT   CDS             286272..286589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54269"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA69"
FT                   /protein_id="ABQ54269.1"
FT                   /translation="MTMMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIV
FT                   GGKIGAYSQMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIGQAGTEVLCYGTAVI
FT                   I"
     MTMMITTGNS FEGKVIKQYL GIVRGIVVRS PTISQGLMGG LKSIVGGKIG AYSQMCEHAR        60
     EEAFQLMIEH AQALNANGII AMRYDTGEIG QAGTEVLCYG TAVII                       105
//

If you have problems or comments...

PBIL Back to PBIL home page