(data stored in ACNUC7421 zone)

EMBL: CP000675.PE279

CP000675.PE279       Location/Qualifiers
FT   CDS             298275..300245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54279"
FT                   /protein_id="ABQ54279.1"
FT                   /translation="MLSKEKINPSLKNTKRQGSDNLAAMADPTSLKNTSDYRCFNSKPE
FT                   AYTYFIFLLNQWQTNYMADKREAIAKAIDSIKMAYENHEQDTLVVHKTLHGLSHLLEQE
FT                   HADELNALCLVPIKDSQSNANNILPRRFESELACRLIESPTKSMMEAIDLVSQAIINLI
FT                   EEYSKLDSKSSERAALNFFLQELEGSDIEFGAFKKRPTLEEVIAILKENNPKNFIQIQF
FT                   ISFMFARNVIGPFPLRNLPPFKPTGLFAQVLDKYLQDHPDLKEEEEGFSYQLMAAKNEA
FT                   EEFRTFITKKLFYQDELYTQGENRGRQGPRKTYLKTNQLGLMKLDHSAHSRGLTVIPEQ
FT                   TWCADAQAQEANQNSIYYKTALTNDCLYVTGPSGMTSIYMNMMLLLLNPQNIELIQAYS
FT                   LGIIAYIVGAGFHSVNEILIPLVKCINLLPNYPSYEGLEYLTHPPLYHEYFKQIAQFDS
FT                   DFIQLRDQVWIHYLNYFKSCYMPLCMRDFCEAEQLANCPDAAPEVKILCSIVLKSIEDC
FT                   INFHNLNRHLDSRFLGTTTADIDALNQLKEACASQSSISGIMRLLQKYFSGENIARPTA
FT                   MHKFETRSYIRFFLDALKDNPQIISHINEKMKLDPPLTISTKAEIFSDDFRIECFNVHR
FT                   ILKREHQVSEDCNNTSQFLKL"
     MLSKEKINPS LKNTKRQGSD NLAAMADPTS LKNTSDYRCF NSKPEAYTYF IFLLNQWQTN        60
     YMADKREAIA KAIDSIKMAY ENHEQDTLVV HKTLHGLSHL LEQEHADELN ALCLVPIKDS       120
     QSNANNILPR RFESELACRL IESPTKSMME AIDLVSQAII NLIEEYSKLD SKSSERAALN       180
     FFLQELEGSD IEFGAFKKRP TLEEVIAILK ENNPKNFIQI QFISFMFARN VIGPFPLRNL       240
     PPFKPTGLFA QVLDKYLQDH PDLKEEEEGF SYQLMAAKNE AEEFRTFITK KLFYQDELYT       300
     QGENRGRQGP RKTYLKTNQL GLMKLDHSAH SRGLTVIPEQ TWCADAQAQE ANQNSIYYKT       360
     ALTNDCLYVT GPSGMTSIYM NMMLLLLNPQ NIELIQAYSL GIIAYIVGAG FHSVNEILIP       420
     LVKCINLLPN YPSYEGLEYL THPPLYHEYF KQIAQFDSDF IQLRDQVWIH YLNYFKSCYM       480
     PLCMRDFCEA EQLANCPDAA PEVKILCSIV LKSIEDCINF HNLNRHLDSR FLGTTTADID       540
     ALNQLKEACA SQSSISGIMR LLQKYFSGEN IARPTAMHKF ETRSYIRFFL DALKDNPQII       600
     SHINEKMKLD PPLTISTKAE IFSDDFRIEC FNVHRILKRE HQVSEDCNNT SQFLKL           656
//

If you have problems or comments...

PBIL Back to PBIL home page