(data stored in ACNUC7421 zone)

EMBL: CP000675.PE280

CP000675.PE280       Location/Qualifiers
FT   CDS             300326..300913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54280"
FT                   /protein_id="ABQ54280.1"
FT                   /translation="MKNAAIIKNRIFLNLDKPVKRFLASDKADTPMTAEFYAEKDYEQL
FT                   FLDFLSQATGSYDEQISMLIAELDSGADRVAQKLMSALYSPWQKNLFPKAIKTIANKSE
FT                   EYPLMSDLLIKFCQQHVGSIDAVDEFGETALAKILKKDQQRRSPLLFLVKHGAKHCQLT
FT                   SALQDSLIVNNPDIYNVAEDNTMDWVSNRSQA"
     MKNAAIIKNR IFLNLDKPVK RFLASDKADT PMTAEFYAEK DYEQLFLDFL SQATGSYDEQ        60
     ISMLIAELDS GADRVAQKLM SALYSPWQKN LFPKAIKTIA NKSEEYPLMS DLLIKFCQQH       120
     VGSIDAVDEF GETALAKILK KDQQRRSPLL FLVKHGAKHC QLTSALQDSL IVNNPDIYNV       180
     AEDNTMDWVS NRSQA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page