(data stored in ACNUC7421 zone)

EMBL: CP000675.PE284

CP000675.PE284       Location/Qualifiers
FT   CDS             complement(303275..303664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0289"
FT                   /product="murein hydrolase exporter, LrgA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54284"
FT                   /protein_id="ABQ54284.1"
FT                   /translation="MANKIQQNSFFQIILVGLFWLASELLLKLVKLPLSGGILGLGIVL
FT                   LLLATNCLKLNRIRRGAELLLANMLLFFIPGVLAILEHQEFIGLLGLKILFIILLSTIT
FT                   VMLVTALVVDYCYRWRTHHAKQHSL"
     MANKIQQNSF FQIILVGLFW LASELLLKLV KLPLSGGILG LGIVLLLLAT NCLKLNRIRR        60
     GAELLLANML LFFIPGVLAI LEHQEFIGLL GLKILFIILL STITVMLVTA LVVDYCYRWR       120
     THHAKQHSL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page