(data stored in ACNUC7421 zone)

EMBL: CP000675.PE290

CP000675.PE290       Location/Qualifiers
FT   CDS             complement(306710..307549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54290"
FT                   /protein_id="ABQ54290.1"
FT                   /translation="MHYQNQRVLLASKHQKEKAIQPPFEEKLGCRIHVPADYDTDQFGT
FT                   FTGEIPRKASAYETLILKAKAAAKQFGYRYVISSEGSFGPHPQLYFCPADTELMAFVDL
FT                   DNDLIIAEHEVSTETNYSHIDISATDDYEAFLNKAKFPSHGIIVRALNSEENYIQKGIC
FT                   EREQLKTAIQKAFTYSTTIRLETDMRAMMNPLRMNVINKLAVKLVHRIQQYCPQCHTPG
FT                   FGKISSEGHLACISCGTPTELYLRKVLNCLKCEFKTYQARDDGLEFADQRYCPYCNP"
     MHYQNQRVLL ASKHQKEKAI QPPFEEKLGC RIHVPADYDT DQFGTFTGEI PRKASAYETL        60
     ILKAKAAAKQ FGYRYVISSE GSFGPHPQLY FCPADTELMA FVDLDNDLII AEHEVSTETN       120
     YSHIDISATD DYEAFLNKAK FPSHGIIVRA LNSEENYIQK GICEREQLKT AIQKAFTYST       180
     TIRLETDMRA MMNPLRMNVI NKLAVKLVHR IQQYCPQCHT PGFGKISSEG HLACISCGTP       240
     TELYLRKVLN CLKCEFKTYQ ARDDGLEFAD QRYCPYCNP                              279
//

If you have problems or comments...

PBIL Back to PBIL home page