(data stored in ACNUC7421 zone)

EMBL: CP000675.PE292

CP000675.PE292       Location/Qualifiers
FT   CDS             complement(307941..310229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54292"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA92"
FT                   /protein_id="ABQ54292.1"
FT                   /translation="MSSHITLIKTNTNNENQMTQFNYKVDNDVMIIRAMVNNVAKQITP
FT                   VWPLEKFIACNSLHGFESMSFEEAVIQNQTAKKGTPFNEKLERVNWHMIKWCGSFLDIG
FT                   QGTLEMPHRDKGLYFGFLKLAPFDSELHQNNKSTKSWLSNLPEMPEQAIRLCLNKLGVL
FT                   NQKQEKFLKSTLSHLPGWAGYIKWISEWKNRNGKEENPVSLADFLAVRLIITCVLWPEA
FT                   SQEEKKKKKDNAYTKQLIQNIKNKEDDYRQLLLNKLLPELDKVQIKENRANAQMVFCID
FT                   VRSEPFRRCIEKLGHYETLGFAGFFGLPVSIKDYDGETIKDSCPVLLKPRFNIHEKAIA
FT                   ANEHCIEHHEKGKEFKNILNRIYQQLKYNFSTPFALVESLGIWCGITMFLKSCSPIFAR
FT                   RLTKDLNEMICPSIQTQPVFELDLLEKEVGISLQEQIAYAEMALRLMGLTDNFAKLVIF
FT                   CGHGSSTQNNPYASALDCGACGGNQGGKNAQLLASILNKIIVRRALAENGINIPQDTLF
FT                   YGAQHDTTTDEVEIYHSNVSQFIHQDILDQLRTDLNIAKHNNNLERINYLNSIDCAEKD
FT                   IARRSTDWSETRPEWGLARNAAFIVAPRQLTKNINLEGRCFLHSYDWSQDKDGALLETI
FT                   LTAPMVVAQWINTQYLFSTIDNVAYGSGSKITHNVAGKIGVMQGNASDLMHGLPLQSVM
FT                   SHDDKSFHEPQRLLTLVYAPREIISELVEKHDVLKTLFFNEWVHLVAIDPRSHLFYKLE
FT                   KTNTWSVIQ"
     MSSHITLIKT NTNNENQMTQ FNYKVDNDVM IIRAMVNNVA KQITPVWPLE KFIACNSLHG        60
     FESMSFEEAV IQNQTAKKGT PFNEKLERVN WHMIKWCGSF LDIGQGTLEM PHRDKGLYFG       120
     FLKLAPFDSE LHQNNKSTKS WLSNLPEMPE QAIRLCLNKL GVLNQKQEKF LKSTLSHLPG       180
     WAGYIKWISE WKNRNGKEEN PVSLADFLAV RLIITCVLWP EASQEEKKKK KDNAYTKQLI       240
     QNIKNKEDDY RQLLLNKLLP ELDKVQIKEN RANAQMVFCI DVRSEPFRRC IEKLGHYETL       300
     GFAGFFGLPV SIKDYDGETI KDSCPVLLKP RFNIHEKAIA ANEHCIEHHE KGKEFKNILN       360
     RIYQQLKYNF STPFALVESL GIWCGITMFL KSCSPIFARR LTKDLNEMIC PSIQTQPVFE       420
     LDLLEKEVGI SLQEQIAYAE MALRLMGLTD NFAKLVIFCG HGSSTQNNPY ASALDCGACG       480
     GNQGGKNAQL LASILNKIIV RRALAENGIN IPQDTLFYGA QHDTTTDEVE IYHSNVSQFI       540
     HQDILDQLRT DLNIAKHNNN LERINYLNSI DCAEKDIARR STDWSETRPE WGLARNAAFI       600
     VAPRQLTKNI NLEGRCFLHS YDWSQDKDGA LLETILTAPM VVAQWINTQY LFSTIDNVAY       660
     GSGSKITHNV AGKIGVMQGN ASDLMHGLPL QSVMSHDDKS FHEPQRLLTL VYAPREIISE       720
     LVEKHDVLKT LFFNEWVHLV AIDPRSHLFY KLEKTNTWSV IQ                          762
//

If you have problems or comments...

PBIL Back to PBIL home page