(data stored in ACNUC7421 zone)

EMBL: CP000675.PE293

CP000675.PE293       Location/Qualifiers
FT   CDS             complement(310244..311764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0298"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54293"
FT                   /protein_id="ABQ54293.1"
FT                   /translation="MDKLLNGLSISLMLSPLIAMLFYSLLGKTRNIQATYYGTTVIGFG
FT                   FGLSLLALIVSANTVNQNSYFLFHASTLSLLLSTLILFISFIIHRFSLRYMHGDKCYRR
FT                   YFFKLSAITLTTVVMALADNLLLFWLAWSASNLLLINLMIHKSQWKAAYNSGILTLKTL
FT                   LPGSLLLITAFWILFTLNNTLSIETITSEVSNKSSPAIAVALGFIILTAMTQSAIWPFH
FT                   RWLISSLNSPTPVSALMHAGLVNGGGFLIVKFAPLFVMQTNLLTILFIFGALTALLGTL
FT                   WKLLQWNIKSMLASSTMAQMGFMIMQCGLGLFPAAIAHLCWHGLFKSYLFLNSGSAVQQ
FT                   KKYQNKSRPEKLTTLLTAFFGGLLGMYGFALITGKPILSLHASTFLLGFAFITGTQFTL
FT                   GLIAYEKHFKKVILALALVFSIGIFYGGSIHLIESLLPDLTGFPQHQLSSLQVLTLIVF
FT                   FSLWLVFSMGLFKKIRETRLWDWFYMYMFNASTPHPKTITANRHTYYY"
     MDKLLNGLSI SLMLSPLIAM LFYSLLGKTR NIQATYYGTT VIGFGFGLSL LALIVSANTV        60
     NQNSYFLFHA STLSLLLSTL ILFISFIIHR FSLRYMHGDK CYRRYFFKLS AITLTTVVMA       120
     LADNLLLFWL AWSASNLLLI NLMIHKSQWK AAYNSGILTL KTLLPGSLLL ITAFWILFTL       180
     NNTLSIETIT SEVSNKSSPA IAVALGFIIL TAMTQSAIWP FHRWLISSLN SPTPVSALMH       240
     AGLVNGGGFL IVKFAPLFVM QTNLLTILFI FGALTALLGT LWKLLQWNIK SMLASSTMAQ       300
     MGFMIMQCGL GLFPAAIAHL CWHGLFKSYL FLNSGSAVQQ KKYQNKSRPE KLTTLLTAFF       360
     GGLLGMYGFA LITGKPILSL HASTFLLGFA FITGTQFTLG LIAYEKHFKK VILALALVFS       420
     IGIFYGGSIH LIESLLPDLT GFPQHQLSSL QVLTLIVFFS LWLVFSMGLF KKIRETRLWD       480
     WFYMYMFNAS TPHPKTITAN RHTYYY                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page