(data stored in ACNUC7421 zone)

EMBL: CP000675.PE295

CP000675.PE295       Location/Qualifiers
FT   CDS             312759..314348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0300"
FT                   /product="toxin secretion ABC transporter HlyB/MsbA family
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54295"
FT                   /protein_id="ABQ54295.1"
FT                   /translation="MNAKPINSIIDVLDRQTISSIAMISVIISLLSLSIPIAAQTLVNL
FT                   IAFGKLLQPVITLSLMVLVLMMALGALHIWQIVIIEVIQQKLMVKVSLSLTRHFTHMSL
FT                   DNFSTHHGPELVNRFFEIVTIKKSLASLLLYGINLGLQLFFGLLLILIYHPLFLLFDIF
FT                   IIIGILLIIFIPYKKALDSAKKECSEKHVVGAWLEEILINRYLFRFNLHHRYVTQQTDK
FT                   KLVAFLKARNTHFKQLIKHQIGFYMLSALASSLLLGLGGYLVINNQLSLGQLVAAEIVL
FT                   GALIYSFRRFGALLENYYDLVASENKIDAVLNLSLEQVKEDEHGELLTPINSIQLEMDS
FT                   KNKALIAVDKPLLVFSEKSDLCQLFVEQLFGFQDPVSLHVLINEIPCAKRTLISLRRFS
FT                   LLIAEPQWFTGSIYDNLVLNHRNMSNKIIIEQLQNVGLADKIIQLPEGLHTIVYEWQDV
FT                   FTSVELTKLMLVRALLLQPELIVIDRAFDILNHQEVNEMMELVLSLKNTLLLIVSQRSD
FT                   FNYLNNRLVISS"
     MNAKPINSII DVLDRQTISS IAMISVIISL LSLSIPIAAQ TLVNLIAFGK LLQPVITLSL        60
     MVLVLMMALG ALHIWQIVII EVIQQKLMVK VSLSLTRHFT HMSLDNFSTH HGPELVNRFF       120
     EIVTIKKSLA SLLLYGINLG LQLFFGLLLI LIYHPLFLLF DIFIIIGILL IIFIPYKKAL       180
     DSAKKECSEK HVVGAWLEEI LINRYLFRFN LHHRYVTQQT DKKLVAFLKA RNTHFKQLIK       240
     HQIGFYMLSA LASSLLLGLG GYLVINNQLS LGQLVAAEIV LGALIYSFRR FGALLENYYD       300
     LVASENKIDA VLNLSLEQVK EDEHGELLTP INSIQLEMDS KNKALIAVDK PLLVFSEKSD       360
     LCQLFVEQLF GFQDPVSLHV LINEIPCAKR TLISLRRFSL LIAEPQWFTG SIYDNLVLNH       420
     RNMSNKIIIE QLQNVGLADK IIQLPEGLHT IVYEWQDVFT SVELTKLMLV RALLLQPELI       480
     VIDRAFDILN HQEVNEMMEL VLSLKNTLLL IVSQRSDFNY LNNRLVISS                   529
//

If you have problems or comments...

PBIL Back to PBIL home page