(data stored in ACNUC7421 zone)

EMBL: CP000675.PE297

CP000675.PE297       Location/Qualifiers
FT   CDS             315328..316725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0302"
FT                   /product="multidrug efflux protein, outer membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54297"
FT                   /protein_id="ABQ54297.1"
FT                   /translation="MICFPSGKNRLMVLCLFLMLSFKCFPIPAKPLLLDAVLKSVDRSY
FT                   PQIVIARLEIRKAEGDYVNALGKFDPSFDVNPRFQPVGGYINNYADNLFNVPTLYNGLK
FT                   LFGGYRIGRGDWPIYYQNYLTNSGGEYRAGLSLPLLRDRRIDKERTELFTREETIRMKQ
FT                   QDAAATKIKIYQETIKAYWQWVEAGFQLRTFRHLLNLAKERQNAIIQQAQQGDLPRLAI
FT                   AENLQLIVQREQLVNQGEMLLAQAGINLSLYYRDANGKPQKPDESQLPATFPAQPIRVS
FT                   NSISQLQRHPVLRKLENYSKIVKLKQNLARNELLPNLDATAYTFKQYGTGGYPLLIPQA
FT                   AMIGVNFKFPIFQREARGKLISTTSELQQVKTEMKFTYEQLNNELSNLLVAIRIYQQQV
FT                   VLLNKELNLARQVEKGETKRFYEGDSTLFLVNQREQTTAQVKLNWINAEVNLQEATALA
FT                   RFFSSTQ"
     MICFPSGKNR LMVLCLFLML SFKCFPIPAK PLLLDAVLKS VDRSYPQIVI ARLEIRKAEG        60
     DYVNALGKFD PSFDVNPRFQ PVGGYINNYA DNLFNVPTLY NGLKLFGGYR IGRGDWPIYY       120
     QNYLTNSGGE YRAGLSLPLL RDRRIDKERT ELFTREETIR MKQQDAAATK IKIYQETIKA       180
     YWQWVEAGFQ LRTFRHLLNL AKERQNAIIQ QAQQGDLPRL AIAENLQLIV QREQLVNQGE       240
     MLLAQAGINL SLYYRDANGK PQKPDESQLP ATFPAQPIRV SNSISQLQRH PVLRKLENYS       300
     KIVKLKQNLA RNELLPNLDA TAYTFKQYGT GGYPLLIPQA AMIGVNFKFP IFQREARGKL       360
     ISTTSELQQV KTEMKFTYEQ LNNELSNLLV AIRIYQQQVV LLNKELNLAR QVEKGETKRF       420
     YEGDSTLFLV NQREQTTAQV KLNWINAEVN LQEATALARF FSSTQ                       465
//

If you have problems or comments...

PBIL Back to PBIL home page