(data stored in ACNUC7421 zone)

EMBL: CP000675.PE298

CP000675.PE298       Location/Qualifiers
FT   CDS             316987..318009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54298"
FT                   /protein_id="ABQ54298.1"
FT                   /translation="MNTTSRKSKTYDRWKQVEGIYGVRLQDILNVDLTKLHDSPYTYKS
FT                   ELLFLLQMSLRNIAVIVNKEDLIKRIIEEGRSKDQTKIEGSNAYCKFMELVQLYLYRRD
FT                   SLARISQFNELALSPEIVQTAQDIARILGPILRNQPFHQVQKIENAFVKEVLLNDVLSG
FT                   NTINSNSIILKSLEKIKEQGRWATHDDLKEIADLLKINLNVVGQPNGKPLPEYPTVTLK
FT                   NLSNTHWITQVESLQGPRQYSTPRKRAFGYETVSDRAVPLKEEQTLDRTFRTQTQSERA
FT                   KRYRQHFETLFDTLSPYGFFTYEQNKRNTQVSGKVQTGLESDESLAARLQEAELRRILY
FT                   "
     MNTTSRKSKT YDRWKQVEGI YGVRLQDILN VDLTKLHDSP YTYKSELLFL LQMSLRNIAV        60
     IVNKEDLIKR IIEEGRSKDQ TKIEGSNAYC KFMELVQLYL YRRDSLARIS QFNELALSPE       120
     IVQTAQDIAR ILGPILRNQP FHQVQKIENA FVKEVLLNDV LSGNTINSNS IILKSLEKIK       180
     EQGRWATHDD LKEIADLLKI NLNVVGQPNG KPLPEYPTVT LKNLSNTHWI TQVESLQGPR       240
     QYSTPRKRAF GYETVSDRAV PLKEEQTLDR TFRTQTQSER AKRYRQHFET LFDTLSPYGF       300
     FTYEQNKRNT QVSGKVQTGL ESDESLAARL QEAELRRILY                             340
//

If you have problems or comments...

PBIL Back to PBIL home page