(data stored in ACNUC7421 zone)

EMBL: CP000675.PE306

CP000675.PE306       Location/Qualifiers
FT   CDS             complement(332014..332496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54306"
FT                   /protein_id="ABQ54306.1"
FT                   /translation="MATYYGQCACGKIQFICTGEPVFTQYCHCNKCREIASLSQKKQDK
FT                   SGYSLTAAYLTRDFRIVSEENDFEEIIKEKAKLFLCSYCHSLVYGISLDPRQQDSIGIN
FT                   VNNFKFDTNIPDSFKPIRHIWYACRIMDCDDQLPKFKDAPKEQFGSGELFELPNAN"
     MATYYGQCAC GKIQFICTGE PVFTQYCHCN KCREIASLSQ KKQDKSGYSL TAAYLTRDFR        60
     IVSEENDFEE IIKEKAKLFL CSYCHSLVYG ISLDPRQQDS IGINVNNFKF DTNIPDSFKP       120
     IRHIWYACRI MDCDDQLPKF KDAPKEQFGS GELFELPNAN                             160
//

If you have problems or comments...

PBIL Back to PBIL home page