(data stored in ACNUC7421 zone)

EMBL: CP000675.PE319

CP000675.PE319       Location/Qualifiers
FT   CDS             348554..349507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54319"
FT                   /protein_id="ABQ54319.1"
FT                   /translation="MRLSYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLATRAERY
FT                   FWRTLHEGRYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLP
FT                   NEIILSKKYFADALQLDPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWP
FT                   EFNYFTAGYPMSSLSADSDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGT
FT                   QRACWNSEIAPHNFEGFFMNMGDMLVKSGDPETGIKIYNNAKLAKNYNKWPYKDMLEKR
FT                   VLNAKANVQHFNQKSNDPNQSIMFNSGYGCVVCHQR"
     MRLSYGLLGF MIFNLVACEK MALLTTPPKK QQLSNSPLAT RAERYFWRTL HEGRYQDIPQ        60
     ADYLLMAAYL ENPYDSKLAA HLGFIHIWKI TERERVKNNS PLLPNEIILS KKYFADALQL       120
     DPENPIYQGF YGDTQLVEGQ IFKDKQEEVR GYFTLQKAIS NWPEFNYFTA GYPMSSLSAD       180
     SDHFKKGLDW QWKTLDICAG EKISRQNPDF TPYMKRETTI GTQRACWNSE IAPHNFEGFF       240
     MNMGDMLVKS GDPETGIKIY NNAKLAKNYN KWPYKDMLEK RVLNAKANVQ HFNQKSNDPN       300
     QSIMFNSGYG CVVCHQR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page