(data stored in ACNUC7421 zone)

EMBL: CP000675.PE323

CP000675.PE323       Location/Qualifiers
FT   CDS             352942..353217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0328"
FT                   /product="RNA binding protein, cold-inducible rrm"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54323"
FT                   /protein_id="ABQ54323.1"
FT                   /translation="MKQKKIYVGNLPFGTTEEALSIQFSQYGKIEEMFLIKDRLTGQMK
FT                   GFGFITFSAQQEAESALEMNGQPFDGRSLKVCMAQKKTNSVSRSRW"
     MKQKKIYVGN LPFGTTEEAL SIQFSQYGKI EEMFLIKDRL TGQMKGFGFI TFSAQQEAES        60
     ALEMNGQPFD GRSLKVCMAQ KKTNSVSRSR W                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page