(data stored in ACNUC7421 zone)

EMBL: CP000675.PE326

CP000675.PE326       Location/Qualifiers
FT   CDS             354882..355409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54326"
FT                   /protein_id="ABQ54326.1"
FT                   /translation="MYNKMFKPLDTDPILYFKMYSNYTEGRVDDCCAFILMPSGLQREW
FT                   VCLQSIQFAFNKRGDVLGINIIFSGNESNIHKKVRETMEGMLKLKLQYGRGEELFVFDE
FT                   EKKTFHMGIVPGKDTQAYLEGIIAFIKDSYRLQPDFAQDIKSQLLSKEYLAQEYSRLRW
FT                   KPPEKETVCVLM"
     MYNKMFKPLD TDPILYFKMY SNYTEGRVDD CCAFILMPSG LQREWVCLQS IQFAFNKRGD        60
     VLGINIIFSG NESNIHKKVR ETMEGMLKLK LQYGRGEELF VFDEEKKTFH MGIVPGKDTQ       120
     AYLEGIIAFI KDSYRLQPDF AQDIKSQLLS KEYLAQEYSR LRWKPPEKET VCVLM            175
//

If you have problems or comments...

PBIL Back to PBIL home page