(data stored in ACNUC7421 zone)

EMBL: CP000675.PE327

CP000675.PE327       Location/Qualifiers
FT   CDS             355564..356910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0332"
FT                   /product="outer membrane channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54327"
FT                   /protein_id="ABQ54327.1"
FT                   /translation="MYRKRWLILLCALLNNGCLWLGSEYRKPHVNTPQKWPHKYSIQTE
FT                   QAAYLPDLHWWKQFNSKELNASIQKALQNNHQIHLAMANIESAQGQLRQVQLSWLPNLT
FT                   GLAGYTQFPVLGNPGTTAIAYPAYIINIFQQYKQQKSAQAMLEASIYAQYSARLVVIAQ
FT                   TAASFFTLVAQNEALHLYNKLLKDYRTYLKLTQSQYRSGLISLDNITQIKSHIQRIEAQ
FT                   IKVVQHNIVVTKNALHFLFNENPGDVETKTLFENIDSNQLVPGNLPASVLRVRPDIHEA
FT                   EALLKAAHADVGAIAANLLPGINLGAYLGEGSNVDGAIKLGQAYLNGPIIDLPLFAQVD
FT                   VSKARYKAIYIKYITTIRKALRDVANDLSAYSTSSQQLNNNLSALSDEKQQCHLAEVRY
FT                   RHGIDDYLNLIKCQILLDEFKLVINQNKLEKLLSIVALYQDLGGGYRGH"
     MYRKRWLILL CALLNNGCLW LGSEYRKPHV NTPQKWPHKY SIQTEQAAYL PDLHWWKQFN        60
     SKELNASIQK ALQNNHQIHL AMANIESAQG QLRQVQLSWL PNLTGLAGYT QFPVLGNPGT       120
     TAIAYPAYII NIFQQYKQQK SAQAMLEASI YAQYSARLVV IAQTAASFFT LVAQNEALHL       180
     YNKLLKDYRT YLKLTQSQYR SGLISLDNIT QIKSHIQRIE AQIKVVQHNI VVTKNALHFL       240
     FNENPGDVET KTLFENIDSN QLVPGNLPAS VLRVRPDIHE AEALLKAAHA DVGAIAANLL       300
     PGINLGAYLG EGSNVDGAIK LGQAYLNGPI IDLPLFAQVD VSKARYKAIY IKYITTIRKA       360
     LRDVANDLSA YSTSSQQLNN NLSALSDEKQ QCHLAEVRYR HGIDDYLNLI KCQILLDEFK       420
     LVINQNKLEK LLSIVALYQD LGGGYRGH                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page