(data stored in ACNUC7421 zone)

EMBL: CP000675.PE328

CP000675.PE328       Location/Qualifiers
FT   CDS             356900..357937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0333"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54328"
FT                   /protein_id="ABQ54328.1"
FT                   /translation="MGIDQQKTVRTLRLSLTCIFLFLITWYYQVPESAWTLVTIWFVMY
FT                   EYSTVGGVLTKSFLRFAGTALSAIYGMIVVYFCANNPLINIMALVPGLFLYAYFFMGGD
FT                   KTYIGTIGAVTLTIVLLNYNDIDTAVLRVFNVIIGVIGSMFMIRFFYPQYARDKVLEIQ
FT                   LNFITQLANLLESYLNPTQPLAAIQTKYLDYERKMLDGFTLYNRYIGEAKIEAKKAPFF
FT                   IPHSIAAMQHFRRLFRLFSVFVYYLSTEEIRSDPWVCDQLSKLLLNLQSLQRKLLKQDA
FT                   GPIGGDVVAAEPEEEIVIETPNIENKIATEAIVNNMQKEIALLDAEIKEIILIYDVYDI
FT                   RLNEM"
     MGIDQQKTVR TLRLSLTCIF LFLITWYYQV PESAWTLVTI WFVMYEYSTV GGVLTKSFLR        60
     FAGTALSAIY GMIVVYFCAN NPLINIMALV PGLFLYAYFF MGGDKTYIGT IGAVTLTIVL       120
     LNYNDIDTAV LRVFNVIIGV IGSMFMIRFF YPQYARDKVL EIQLNFITQL ANLLESYLNP       180
     TQPLAAIQTK YLDYERKMLD GFTLYNRYIG EAKIEAKKAP FFIPHSIAAM QHFRRLFRLF       240
     SVFVYYLSTE EIRSDPWVCD QLSKLLLNLQ SLQRKLLKQD AGPIGGDVVA AEPEEEIVIE       300
     TPNIENKIAT EAIVNNMQKE IALLDAEIKE IILIYDVYDI RLNEM                       345
//

If you have problems or comments...

PBIL Back to PBIL home page