(data stored in ACNUC7421 zone)

EMBL: CP000675.PE329

CP000675.PE329       Location/Qualifiers
FT   CDS             357994..358986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0334"
FT                   /product="multidrug resistance secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54329"
FT                   /protein_id="ABQ54329.1"
FT                   /translation="MSDKPKAGFPVIILLCVFLFILIYHYSYLFPFTNNAFVVANVRPV
FT                   AANVKGYITNIYVKNEQEVKKGQPLFTVFKAPYELAYRKAVSDVQEAKAQLLLFNKQVE
FT                   KTKYLLQAQKELYEKFRFDYEHNHSALRDHAVSKLTVNTMLKEKNAALSKLKALEKELE
FT                   VNQQQVIVQKKKIDSLIAVMKNAKIDLDETTVYAKQNGAVQDMFVALGTPIKTRKPVFA
FT                   IADTDTLFIQANFNETDLRRVQPGDKVSIFPRMYFGSKIYHGVILSRNWAASRLETHRA
FT                   TQIQIVRNSESNWFLLPQRLPVQIQITDYDPVHYPLSIGASAYVYIHTH"
     MSDKPKAGFP VIILLCVFLF ILIYHYSYLF PFTNNAFVVA NVRPVAANVK GYITNIYVKN        60
     EQEVKKGQPL FTVFKAPYEL AYRKAVSDVQ EAKAQLLLFN KQVEKTKYLL QAQKELYEKF       120
     RFDYEHNHSA LRDHAVSKLT VNTMLKEKNA ALSKLKALEK ELEVNQQQVI VQKKKIDSLI       180
     AVMKNAKIDL DETTVYAKQN GAVQDMFVAL GTPIKTRKPV FAIADTDTLF IQANFNETDL       240
     RRVQPGDKVS IFPRMYFGSK IYHGVILSRN WAASRLETHR ATQIQIVRNS ESNWFLLPQR       300
     LPVQIQITDY DPVHYPLSIG ASAYVYIHTH                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page