(data stored in ACNUC7421 zone)

EMBL: CP000675.PE331

CP000675.PE331       Location/Qualifiers
FT   CDS             361124..362908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54331"
FT                   /protein_id="ABQ54331.1"
FT                   /translation="MKREFFQKLDKILDIASEHKQMLLQYPDVVMVGVGPERRKGKITG
FT                   EPAIIVTVRKKRSSNELKKRGEKPLPQTIKGIPVDVIELGKAVEAPEIIAVQEKAKKTI
FT                   SKIRAKWLQTPNITAIGYGYKEKGGEIDFNTIAIQFFVKKKFPMVELQKQQITPIPEKI
FT                   NGVSTDVIQLSPIRPAAASGSRGDRHDPLKGGVAIGVGSKPFHYGTYGATVFDRTTGEQ
FT                   LFLSNQHVLDASPGTDTIQPSPVLLDDSVEVGFQLDVCLPIHFIRLDTPNTTVGTVLAG
FT                   AAVAAAVAAALSDEIDPTRRGQEATMPATGSKTLFETQKVKMDYPELPIPGTPFKVKTA
FT                   WDYERHTDAGIKTFSVSEEKKNPHVLRDKLLITDKKLYHPGDTIRIFGLILPEECAPAS
FT                   QSRNDRQPINPRELEDITHYPNVASSINLDLVASMDSDIASSPARRTNTRAAVINPKRC
FT                   RCDRYHPVAILTPTTEDRAFPVVLRESVFAQKNQIFQDLLTVVKQRDDEKLLERVFVLV
FT                   RYGCIYTGTLRVNNIPAGPWKHFFYVQTVNIATSDMKPLLAAQIIGGLPVSQNAKADLD
FT                   IACGPLTWEDGEFDIELI"
     MKREFFQKLD KILDIASEHK QMLLQYPDVV MVGVGPERRK GKITGEPAII VTVRKKRSSN        60
     ELKKRGEKPL PQTIKGIPVD VIELGKAVEA PEIIAVQEKA KKTISKIRAK WLQTPNITAI       120
     GYGYKEKGGE IDFNTIAIQF FVKKKFPMVE LQKQQITPIP EKINGVSTDV IQLSPIRPAA       180
     ASGSRGDRHD PLKGGVAIGV GSKPFHYGTY GATVFDRTTG EQLFLSNQHV LDASPGTDTI       240
     QPSPVLLDDS VEVGFQLDVC LPIHFIRLDT PNTTVGTVLA GAAVAAAVAA ALSDEIDPTR       300
     RGQEATMPAT GSKTLFETQK VKMDYPELPI PGTPFKVKTA WDYERHTDAG IKTFSVSEEK       360
     KNPHVLRDKL LITDKKLYHP GDTIRIFGLI LPEECAPASQ SRNDRQPINP RELEDITHYP       420
     NVASSINLDL VASMDSDIAS SPARRTNTRA AVINPKRCRC DRYHPVAILT PTTEDRAFPV       480
     VLRESVFAQK NQIFQDLLTV VKQRDDEKLL ERVFVLVRYG CIYTGTLRVN NIPAGPWKHF       540
     FYVQTVNIAT SDMKPLLAAQ IIGGLPVSQN AKADLDIACG PLTWEDGEFD IELI             594
//

If you have problems or comments...

PBIL Back to PBIL home page