(data stored in ACNUC7421 zone)

EMBL: CP000675.PE334

CP000675.PE334       Location/Qualifiers
FT   CDS             364458..365732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0339"
FT                   /product="MFS transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54334"
FT                   /protein_id="ABQ54334.1"
FT                   /translation="MNSQKDLKQLDIKQVIAWAFYDFANSSYFVVIFTFVFATYFTSYI
FT                   APNTILGTELWGYTISVSALLIALVSPIVGAIADFSGHHKSWLFVFTYLGVISTGCLWF
FT                   AYPDSHSIPLVLTCILISNFALEVATVFYNSFLANLAPENYLGRISGWAWGCGYLGGLL
FT                   CLILSLFVFVKGELGGLWFGTENFANIRAVTVFVALWISVFSLPLFLVVQQKTGEHLTV
FT                   GTAIRKGLQELWLTIISLPKQRDLFLFLIARIFYIDGLNSILALGGIYVAGNFHLSVSD
FT                   IMVFGIILNITAGLGAGLFAWFDDWIGSKKTILIALACLTLTFCFLLTIHSNTLFWVFA
FT                   PVFGIFVGPVQAASRTFLARLAKPEEMTRMYGFYSFSGKATSFLGPFLVSTTTALADSQ
FT                   RLGMAVLIPFFIIGGGLLLLVHENE"
     MNSQKDLKQL DIKQVIAWAF YDFANSSYFV VIFTFVFATY FTSYIAPNTI LGTELWGYTI        60
     SVSALLIALV SPIVGAIADF SGHHKSWLFV FTYLGVISTG CLWFAYPDSH SIPLVLTCIL       120
     ISNFALEVAT VFYNSFLANL APENYLGRIS GWAWGCGYLG GLLCLILSLF VFVKGELGGL       180
     WFGTENFANI RAVTVFVALW ISVFSLPLFL VVQQKTGEHL TVGTAIRKGL QELWLTIISL       240
     PKQRDLFLFL IARIFYIDGL NSILALGGIY VAGNFHLSVS DIMVFGIILN ITAGLGAGLF       300
     AWFDDWIGSK KTILIALACL TLTFCFLLTI HSNTLFWVFA PVFGIFVGPV QAASRTFLAR       360
     LAKPEEMTRM YGFYSFSGKA TSFLGPFLVS TTTALADSQR LGMAVLIPFF IIGGGLLLLV       420
     HENE                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page