(data stored in ACNUC7421 zone)

EMBL: CP000675.PE336

CP000675.PE336       Location/Qualifiers
FT   CDS             complement(366564..368105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54336"
FT                   /protein_id="ABQ54336.1"
FT                   /translation="MTNTTDFYSITPLDKARWQKILINKITVRTLGKIFVFIMAITIMI
FT                   TLFNFSYATDSKLKPTVITVSEEEFQVDGKGKKTKEFKLTFTHPDGTKDNKGYFANKGD
FT                   MFHVLVENKSASPITLHWHGLIVPSDQDGVPGVSQILIPPGQNKLFNYRLLQAGTYWMH
FT                   SHQKFQEQKQLSAPLIIYDTDDPHKNLQEVILFLEDFTYKDPQLIFDQLRTAKMDMKKM
FT                   DSGNDLNDVTYDAFLANKKTLAAPDVISVQPSKKVRLRIINASSSTNFKIDTGKLSATL
FT                   IAVDGENIEPIVDSSFPIGVGNRMDLLVEIPSAGGAFPVKAMAEGTNKQTGLVLTTDNT
FT                   PTPILSPNTTNKTGRVNYYELEKKLKGKNALTNKKINARLHYVLDGQMNGYIWTMNKQS
FT                   WPDVTPKVIHFGDRVEMIYENKSSMSHPMHFHGHVFQVTEIDGQPLDGAMRDTLLVQPH
FT                   STVKVQFDALNPGIWANHCHNLYHLNAGMFTTFEYQHYPKPDFYLKTIGQPKSNN"
     MTNTTDFYSI TPLDKARWQK ILINKITVRT LGKIFVFIMA ITIMITLFNF SYATDSKLKP        60
     TVITVSEEEF QVDGKGKKTK EFKLTFTHPD GTKDNKGYFA NKGDMFHVLV ENKSASPITL       120
     HWHGLIVPSD QDGVPGVSQI LIPPGQNKLF NYRLLQAGTY WMHSHQKFQE QKQLSAPLII       180
     YDTDDPHKNL QEVILFLEDF TYKDPQLIFD QLRTAKMDMK KMDSGNDLND VTYDAFLANK       240
     KTLAAPDVIS VQPSKKVRLR IINASSSTNF KIDTGKLSAT LIAVDGENIE PIVDSSFPIG       300
     VGNRMDLLVE IPSAGGAFPV KAMAEGTNKQ TGLVLTTDNT PTPILSPNTT NKTGRVNYYE       360
     LEKKLKGKNA LTNKKINARL HYVLDGQMNG YIWTMNKQSW PDVTPKVIHF GDRVEMIYEN       420
     KSSMSHPMHF HGHVFQVTEI DGQPLDGAMR DTLLVQPHST VKVQFDALNP GIWANHCHNL       480
     YHLNAGMFTT FEYQHYPKPD FYLKTIGQPK SNN                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page