(data stored in ACNUC7421 zone)

EMBL: CP000675.PE337

CP000675.PE337       Location/Qualifiers
FT   CDS             368334..368768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54337"
FT                   /protein_id="ABQ54337.1"
FT                   /translation="MKRIFLISIIGIVLNSAYAFEHLGECGAHTWHEVTSKSGSWKITL
FT                   KMISQNGQFVDPSCAEIIETGLAQNNPLSYGLKFSKDADFNLAYTLTAVSEEQGFQSKA
FT                   CVFVITANGPAQPDIQALSYHGAECTWRVIKGIGENFSVG"
     MKRIFLISII GIVLNSAYAF EHLGECGAHT WHEVTSKSGS WKITLKMISQ NGQFVDPSCA        60
     EIIETGLAQN NPLSYGLKFS KDADFNLAYT LTAVSEEQGF QSKACVFVIT ANGPAQPDIQ       120
     ALSYHGAECT WRVIKGIGEN FSVG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page