(data stored in ACNUC7421 zone)

EMBL: CP000675.PE338

CP000675.PE338       Location/Qualifiers
FT   CDS             complement(368783..369763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54338"
FT                   /protein_id="ABQ54338.1"
FT                   /translation="MHSFDSIAVEFDLKNHSMQKIAIEDLNIDYQDKDKIYWIHSDLNQ
FT                   KNIFKKLREKLRLPEEVIQLCGEKDNRSTTIEIDEALTLQIQGLCSMKLNDNYDADFGN
FT                   LIIHLTPNYCFTASKTLSSVLFDLLKSCPKSLPYAKTSCFLLFLLLEGVINDYAKIHLA
FT                   YEELADQLDAQARTTNKNTYSQVLELKHGVMKIKRYTIAIREILMRLTSRNILVISEQC
FT                   RTSLYNLSNHCHLIVNEIDSLRDMLNGLLGQIDNQLMQNMNETMKVLTAFAAIFLPLSL
FT                   ITGIYGMNFYWMPELGWKYGYFWALGLIVLCALLLFLIFRKKKWF"
     MHSFDSIAVE FDLKNHSMQK IAIEDLNIDY QDKDKIYWIH SDLNQKNIFK KLREKLRLPE        60
     EVIQLCGEKD NRSTTIEIDE ALTLQIQGLC SMKLNDNYDA DFGNLIIHLT PNYCFTASKT       120
     LSSVLFDLLK SCPKSLPYAK TSCFLLFLLL EGVINDYAKI HLAYEELADQ LDAQARTTNK       180
     NTYSQVLELK HGVMKIKRYT IAIREILMRL TSRNILVISE QCRTSLYNLS NHCHLIVNEI       240
     DSLRDMLNGL LGQIDNQLMQ NMNETMKVLT AFAAIFLPLS LITGIYGMNF YWMPELGWKY       300
     GYFWALGLIV LCALLLFLIF RKKKWF                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page