(data stored in ACNUC7421 zone)

EMBL: CP000675.PE34

CP000675.PE34        Location/Qualifiers
FT   CDS             41681..42340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54034"
FT                   /protein_id="ABQ54034.1"
FT                   /translation="MLILMMEYTLVCKNKQYHLAKECVLHSKIYNLYHSSTELGDLKAA
FT                   VVKSSRSSKGNTLYYVDLLTSQGPVNLTGSSSSGRDDKEIAANSINNYISNSLETTFKV
FT                   SYPASWWMYGLSVFFLLVGALLLTVRGAITDFDRILKTIVIKRKGLFKTEETKLSFSDV
FT                   DKIIVEESLGSRGTKTYRLAIALKDKPPIPLVTTYDSSFAKKEKIANQLNQFIHES"
     MLILMMEYTL VCKNKQYHLA KECVLHSKIY NLYHSSTELG DLKAAVVKSS RSSKGNTLYY        60
     VDLLTSQGPV NLTGSSSSGR DDKEIAANSI NNYISNSLET TFKVSYPASW WMYGLSVFFL       120
     LVGALLLTVR GAITDFDRIL KTIVIKRKGL FKTEETKLSF SDVDKIIVEE SLGSRGTKTY       180
     RLAIALKDKP PIPLVTTYDS SFAKKEKIAN QLNQFIHES                              219
//

If you have problems or comments...

PBIL Back to PBIL home page