(data stored in ACNUC7421 zone)

EMBL: CP000675.PE348

CP000675.PE348       Location/Qualifiers
FT   CDS             380892..382445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54348"
FT                   /protein_id="ABQ54348.1"
FT                   /translation="MIGMRAEQCNLKSFFVHSLKNKSNLLPLIACFNNREINMPKILDS
FT                   NAYREMENELNNLFEQIYKHGKNDRTAITLQVQQFLDNLSESIRDHSRLLLTNIAREEL
FT                   IYFKEKKPGDSREKFQNIDKMSDYFNNLSALINFSVMQQEDPTLRVFYYDMYIQLMNFC
FT                   YLKGDLFGAGAIYTGLIANNLPNSIDRKQLSSESRLIFKDCEEKFKRLFNLSTTYNEHT
FT                   NLKRQFKTALIPALPSLLTVQIYTKDAYDNSVSDFERVQEKLRQLDIEHNRFLNQLQND
FT                   HSTWSKAYYDYMSNVYLPQSIFEYTTLLREYEELITTHGGPIAKQFHEDKNSEHLVSFV
FT                   ESTLLENQSDLKLSPFQNERIVEMLSEIDVVKSECSSPDVFDDISWKLREMNCTLVKAK
FT                   SIGDYTSKIFANLDTPYMEENTDEDPKPVLVEELQTDDVYQLHHSGMKLIRELEQAIED
FT                   HKPKVIYHCSGEANYGFFKEARRRGRHLSPEPMDIEVMDVDVMDYDENDLRNQTVMITV
FT                   "
     MIGMRAEQCN LKSFFVHSLK NKSNLLPLIA CFNNREINMP KILDSNAYRE MENELNNLFE        60
     QIYKHGKNDR TAITLQVQQF LDNLSESIRD HSRLLLTNIA REELIYFKEK KPGDSREKFQ       120
     NIDKMSDYFN NLSALINFSV MQQEDPTLRV FYYDMYIQLM NFCYLKGDLF GAGAIYTGLI       180
     ANNLPNSIDR KQLSSESRLI FKDCEEKFKR LFNLSTTYNE HTNLKRQFKT ALIPALPSLL       240
     TVQIYTKDAY DNSVSDFERV QEKLRQLDIE HNRFLNQLQN DHSTWSKAYY DYMSNVYLPQ       300
     SIFEYTTLLR EYEELITTHG GPIAKQFHED KNSEHLVSFV ESTLLENQSD LKLSPFQNER       360
     IVEMLSEIDV VKSECSSPDV FDDISWKLRE MNCTLVKAKS IGDYTSKIFA NLDTPYMEEN       420
     TDEDPKPVLV EELQTDDVYQ LHHSGMKLIR ELEQAIEDHK PKVIYHCSGE ANYGFFKEAR       480
     RRGRHLSPEP MDIEVMDVDV MDYDENDLRN QTVMITV                                517
//

If you have problems or comments...

PBIL Back to PBIL home page