(data stored in ACNUC7421 zone)

EMBL: CP000675.PE35

CP000675.PE35        Location/Qualifiers
FT   CDS             complement(42324..42428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54035"
FT                   /protein_id="ABQ54035.1"
FT                   /translation="MTELKIFFNKEIGVFRKSCKPVYNFFGTAISSHG"
     MTELKIFFNK EIGVFRKSCK PVYNFFGTAI SSHG                                    34
//

If you have problems or comments...

PBIL Back to PBIL home page