(data stored in ACNUC7421 zone)

EMBL: CP000675.PE351

CP000675.PE351       Location/Qualifiers
FT   CDS             complement(386179..387345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54351"
FT                   /protein_id="ABQ54351.1"
FT                   /translation="MMKIESFQYIQNQGWSIPTFPALDSENTLILVFASPIFRANSKPI
FT                   EELAQAYKKSKIIGCSTAGEIFGPNIFDNSISVAVVQFESTKLQLAKTEVKSTEESYEA
FT                   GIHLSKSLHQKQNPQSIFVLSDGLNVNGSELIKGLNQHAGKGVIITGGLAGDGADFKNT
FT                   WIIYDGKIVDHCIGAVGFYGNQIHVGHGSRGGWDIFGPERIITRSKANILYELDNQPAL
FT                   KLYKTYLGDRASELPAAGLLYPLAIRNPSAPDSQHIVRTILGVNEEEQSLIFAGDLPKG
FT                   YYAQLMRANFDRLIVSANEAGENANDRLFKNGSLNTQPVLAIDISCVGRRLVLGELTEE
FT                   ETETTLQSLPPKSIQIGFYSYGELSPLATGTCELHNQTMTITTLLESP"
     MMKIESFQYI QNQGWSIPTF PALDSENTLI LVFASPIFRA NSKPIEELAQ AYKKSKIIGC        60
     STAGEIFGPN IFDNSISVAV VQFESTKLQL AKTEVKSTEE SYEAGIHLSK SLHQKQNPQS       120
     IFVLSDGLNV NGSELIKGLN QHAGKGVIIT GGLAGDGADF KNTWIIYDGK IVDHCIGAVG       180
     FYGNQIHVGH GSRGGWDIFG PERIITRSKA NILYELDNQP ALKLYKTYLG DRASELPAAG       240
     LLYPLAIRNP SAPDSQHIVR TILGVNEEEQ SLIFAGDLPK GYYAQLMRAN FDRLIVSANE       300
     AGENANDRLF KNGSLNTQPV LAIDISCVGR RLVLGELTEE ETETTLQSLP PKSIQIGFYS       360
     YGELSPLATG TCELHNQTMT ITTLLESP                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page