(data stored in ACNUC7421 zone)

EMBL: CP000675.PE354

CP000675.PE354       Location/Qualifiers
FT   CDS             complement(389870..390646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54354"
FT                   /protein_id="ABQ54354.1"
FT                   /translation="MSEREWPANDYAIGSYIQATVAEKYLAYLKVNPTDKILDIGCGNG
FT                   AFTKNILLQVPQGSVLGIDASENMLHLAQDMSKKFPNFSVQKADVLTMTFNSQFDYVVS
FT                   FWCLQWACANIQKAFFNIINALKTGGKFLTLFPAGDDPFIMSYYALRKSGQFASLHNFI
FT                   PPVDYSHLNNLEKKLESLTCRDLNVKLCRQSITLPSLDTFRKFVNGIAFYQGQLPNEEI
FT                   KQINEAMVRYYDSECQTKYHGEYQFNFTIYLVTGEK"
     MSEREWPAND YAIGSYIQAT VAEKYLAYLK VNPTDKILDI GCGNGAFTKN ILLQVPQGSV        60
     LGIDASENML HLAQDMSKKF PNFSVQKADV LTMTFNSQFD YVVSFWCLQW ACANIQKAFF       120
     NIINALKTGG KFLTLFPAGD DPFIMSYYAL RKSGQFASLH NFIPPVDYSH LNNLEKKLES       180
     LTCRDLNVKL CRQSITLPSL DTFRKFVNGI AFYQGQLPNE EIKQINEAMV RYYDSECQTK       240
     YHGEYQFNFT IYLVTGEK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page