(data stored in ACNUC7421 zone)

EMBL: CP000675.PE356

CP000675.PE356       Location/Qualifiers
FT   CDS             complement(392171..393295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54356"
FT                   /protein_id="ABQ54356.1"
FT                   /translation="MFTKSCAKATDQNRQELLMDSLLGDFQKMKEKALNQQQEKRSKKR
FT                   EFNSLSSEKTKKPNQYAALTHSQVQEVKAKARTVNDKFHLNAEEKKLWELILLGNQLAQ
FT                   NISSCDLPTDNEDDASLVKLTQIFADETLERTDLTWLNKILKIALYSRGSGFGNCQEKA
FT                   FFAFALLLHQAQKPESLIHSLRLATFNNHFILIVNEQFLMDPWLNLAFPLSKGNQQLEI
FT                   GYVFEGFGRLVNYFSINQEGQCFTHAVREGDTTERDLSSEKDMANCIHSLLDHRDYFDL
FT                   SIVSEREIHTKTKRRKYETQEQEVPQPRQETSNQPKETVYTDSNHNTWDNEGAADDFLE
FT                   HFEQTHPVYNPGFFSFGQDDVGFKPDLPKNLFKF"
     MFTKSCAKAT DQNRQELLMD SLLGDFQKMK EKALNQQQEK RSKKREFNSL SSEKTKKPNQ        60
     YAALTHSQVQ EVKAKARTVN DKFHLNAEEK KLWELILLGN QLAQNISSCD LPTDNEDDAS       120
     LVKLTQIFAD ETLERTDLTW LNKILKIALY SRGSGFGNCQ EKAFFAFALL LHQAQKPESL       180
     IHSLRLATFN NHFILIVNEQ FLMDPWLNLA FPLSKGNQQL EIGYVFEGFG RLVNYFSINQ       240
     EGQCFTHAVR EGDTTERDLS SEKDMANCIH SLLDHRDYFD LSIVSEREIH TKTKRRKYET       300
     QEQEVPQPRQ ETSNQPKETV YTDSNHNTWD NEGAADDFLE HFEQTHPVYN PGFFSFGQDD       360
     VGFKPDLPKN LFKF                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page