(data stored in ACNUC7421 zone)

EMBL: CP000675.PE357

CP000675.PE357       Location/Qualifiers
FT   CDS             393552..394214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54357"
FT                   /protein_id="ABQ54357.1"
FT                   /translation="MSKEQIKKTALEIVEYIHGNIKACNIPNQKRENKFFAPLVYLCQT
FT                   ECDKILSNTKISLLERLLKCAKIVDDLQSGNCMQQAFLAFQRLLTRLIEDKLSNFSTCI
FT                   PISIMTISKHAFLIIDNDIVCDPWLNFVGDLRDYRFAKMKRKEYFGIRSDWTCFTNTEV
FT                   YDEDSTEFTIQFVNALGVGISGFSEVKLANQLMQSSSMASDLGEDPVISIPKEFHQI"
     MSKEQIKKTA LEIVEYIHGN IKACNIPNQK RENKFFAPLV YLCQTECDKI LSNTKISLLE        60
     RLLKCAKIVD DLQSGNCMQQ AFLAFQRLLT RLIEDKLSNF STCIPISIMT ISKHAFLIID       120
     NDIVCDPWLN FVGDLRDYRF AKMKRKEYFG IRSDWTCFTN TEVYDEDSTE FTIQFVNALG       180
     VGISGFSEVK LANQLMQSSS MASDLGEDPV ISIPKEFHQI                             220
//

If you have problems or comments...

PBIL Back to PBIL home page