(data stored in ACNUC7421 zone)

EMBL: CP000675.PE360

CP000675.PE360       Location/Qualifiers
FT   CDS             395614..395844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54360"
FT                   /protein_id="ABQ54360.1"
FT                   /translation="MNKLIVAVTAGASLLLLTGCAVDGVAVDDVSYDSGYSNDYVYSVG
FT                   YYSNRPYWGNNYYSSPSFVGPYGYWGGDYDF"
     MNKLIVAVTA GASLLLLTGC AVDGVAVDDV SYDSGYSNDY VYSVGYYSNR PYWGNNYYSS        60
     PSFVGPYGYW GGDYDF                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page